Protein Info for mRNA_5390 in Rhodosporidium toruloides IFO0880

Name: 13758
Annotation: K03065 PSMC3, RPT5 26S proteasome regulatory subunit T5

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 462 PF16450: Prot_ATP_ID_OB" amino acids 112 to 188 (77 residues), 65.2 bits, see alignment E=1e-21 TIGR01242: 26S proteasome subunit P45 family" amino acids 144 to 446 (303 residues), 382.5 bits, see alignment E=1.1e-118 PF00004: AAA" amino acids 247 to 379 (133 residues), 133.7 bits, see alignment E=1.4e-42 PF17862: AAA_lid_3" amino acids 402 to 442 (41 residues), 39.8 bits, see alignment 8e-14

Best Hits

Swiss-Prot: 72% identical to PRS6A_HUMAN: 26S proteasome regulatory subunit 6A (PSMC3) from Homo sapiens

KEGG orthology group: K03065, 26S proteasome regulatory subunit T5 (inferred from 74% identity to cci:CC1G_07176)

Predicted SEED Role

"proteasome regulatory subunit Rpt5" in subsystem Proteasome eukaryotic

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (462 amino acids)

>mRNA_5390 K03065 PSMC3, RPT5 26S proteasome regulatory subunit T5 (Rhodosporidium toruloides IFO0880)
MDAQPPQDNGSSQQPDKDQPAQPARAHDDATMSDSQPADSAQPKEPEEEPLPDDILNASA
DDIMARTRLIDNDLKVMRSETMRLNHERNKMKEQIKDNTDKIKNNKMLPYLVGNVVEILD
IDPDVDEDTEGANVDLDAQRKGKCAVIKTSTRQTIFLPLVGLVDPATLRPKDLIGVNKDS
YLVLDTLPAEFDSRVKAMEVDEKPTESYNDIGGLDKQIEELVEAIVLPMQQAERFKTLGI
KAPKGCLMYGPPGTGKTLLARACAAQTDACYLKLAAPSLVQMYIGDGAKLVRDAFELAKQ
HKAAIIFIDELDAIGTKRFDSDKSGDREVQRTMLELLNQLDGFSSDDRIKVIAATNRIDV
LDPALLRSGRLDRKIEFPLPNEEARAKIMEIHSRKMKVSPKVNFEELSRSTDEFNGAQLK
AVCVEAGMIALREGFTEINHEHYLSGILEVQSKKKNDHFYFA