Protein Info for mRNA_5403 in Rhodosporidium toruloides IFO0880

Name: 13771
Annotation: K00789 metK S-adenosylmethionine synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00438: S-AdoMet_synt_N
  • amino acids 51 to 144 (94 residues), 130.5 bits, E=4.9e-42
• TIGR01034: methionine adenosyltransferase
  • amino acids 52 to 424 (373 residues), 569.3 bits, E=1.9e-175
• PF02772: S-AdoMet_synt_M
  • amino acids 158 to 278 (121 residues), 160.5 bits, E=3.1e-51
• PF02773: S-AdoMet_synt_C
  • amino acids 280 to 419 (140 residues), 214.9 bits, E=5.9e-68

Best Hits

Swiss-Prot: 72% identical to METK_ASCIM: S-adenosylmethionine synthase from Ascobolus immersus

KEGG orthology group: K00789, S-adenosylmethionine synthetase [EC: 2.5.1.6] (inferred from 80% identity to cci:CC1G_01221)

MetaCyc: 71% identical to Sam2 (Saccharomyces cerevisiae)
Methionine adenosyltransferase. [EC: 2.5.1.6]

Predicted SEED Role

"S-adenosylmethionine synthetase (EC 2.5.1.6)" in subsystem Methionine Biosynthesis or Methionine Degradation or Quorum Sensing: Autoinducer-2 Synthesis (EC 2.5.1.6)

MetaCyc Pathways

• S-adenosyl-L-methionine salvage II (3/3 steps found)
• superpathway of S-adenosyl-L-methionine biosynthesis (7/9 steps found)
• superpathway of L-cysteine biosynthesis (mammalian) (4/5 steps found)
• S-adenosyl-L-methionine biosynthesis (1/1 steps found)
• L-methionine degradation I (to L-homocysteine) (2/3 steps found)
• S-adenosyl-L-methionine salvage I (2/4 steps found)
• L-methionine salvage cycle III (7/11 steps found)
• ethene biosynthesis I (plants) (1/3 steps found)
• L-cysteine biosynthesis VI (from L-methionine) (3/6 steps found)
• 2'-deoxymugineic acid phytosiderophore biosynthesis (1/4 steps found)
• L-methionine salvage cycle I (bacteria and plants) (6/12 steps found)
• aspartate superpathway (15/25 steps found)
• L-methionine salvage cycle II (plants) (4/11 steps found)
• superpathway of L-methionine salvage and degradation (7/16 steps found)

KEGG Metabolic Maps

• Biosynthesis of plant hormones
• Methionine metabolism
• Selenoamino acid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.6

Protein Sequence (425 amino acids)

>mRNA_5403 K00789 metK S-adenosylmethionine synthetase (Rhodosporidium toruloides IFO0880)
MRPSTHRRNRVLLRCRRRKKSALMLADGASRSLGPATRIHAHPRTTMSNTFLFTSESVGE
GHPDQVSDAILDACLAEDPWSKVACETAAKTGLIMVFGEITTKAHVDYQKVIRDTIKRIG
YDSSDKGFDYKTCNVLVAIEQQSPDIAQGLDHGSLENHGAGDQGIMFGYATNETPEMMPL
TLVLAHKLNRKLAECRRSNLPWLRPDTKTQVTVEYEKLANGAVKPLRVDTVVISTQHAEE
ISTEDLQKEIMDKVVEAVIPANLLDDKTVYHIQPSGRFVIGGPQGDAGLTGRKIIVDTYG
GWGAHGGGAFSGKDWSKVDRSAAYTARWIAKSLIAADLAERVLVQLSYAIGVAEPLSIFV
DSYGTVKGGRTDADLTAIITKNFDLRPGAVVKALDLQKPQYERTAYGGHFGREEFTWEQP
KQLQL