Protein Info for mRNA_5424 in Rhodosporidium toruloides IFO0880

Name: 13792
Annotation: KOG0255 Synaptic vesicle transporter SVOP and related transporters (major facilitator superfamily)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 544 transmembrane" amino acids 68 to 90 (23 residues), see Phobius details amino acids 103 to 124 (22 residues), see Phobius details amino acids 136 to 153 (18 residues), see Phobius details amino acids 166 to 188 (23 residues), see Phobius details amino acids 195 to 214 (20 residues), see Phobius details amino acids 225 to 244 (20 residues), see Phobius details amino acids 327 to 352 (26 residues), see Phobius details amino acids 369 to 394 (26 residues), see Phobius details amino acids 415 to 435 (21 residues), see Phobius details amino acids 441 to 466 (26 residues), see Phobius details amino acids 478 to 496 (19 residues), see Phobius details amino acids 508 to 529 (22 residues), see Phobius details PF07690: MFS_1" amino acids 72 to 486 (415 residues), 107.3 bits, see alignment E=8.3e-35 PF00083: Sugar_tr" amino acids 108 to 246 (139 residues), 62.3 bits, see alignment E=4.3e-21

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (544 amino acids)

>mRNA_5424 KOG0255 Synaptic vesicle transporter SVOP and related transporters (major facilitator superfamily) (Rhodosporidium toruloides IFO0880)
MAFGILEPKNVSNPLDVLGTAALEETQTTESDVFSKHAPGRPDLILVPTPSDDPLDPLNW
SRFRKEAAYAVLLLGTCLAGTCGPLVAPAFVEMSHQLERPLSQIATGLNGSLVFAIGVGS
CIFAPIQTKWGTRPSFLIASVVAFVSQIWAGASGTNFPSLCAARVLQGLAMGCWFNGAPS
AIAAITFVHERGFRIALWNLGLVGGINLGPVISAQICQRQGWHFAFWWQSLAAGLVLLGT
IFLVPEMEYDRSYYYAELERRREMLTSGSGSPSEDKFVPEQKEIVLGKVVTAPRDIERGT
RSRWTQYRFSTGSKTDVSFLTLFLRPFYYFISPTIIWAALTFSVCFKLLPLAATVYAQVF
GAPPYNLTVGGIGLVGGIPPLIGTLIGTFATGPLSDMSAKYLSKRNNGIYEPEFRLLPMI
LFLVFGGMGFYGWGLQQSSSWIVPAIFIAILHIGVSAATISCISYVTDSLRAGAADGLGL
VVFIKSSIGFGITFIINDWYAARGPRQFFVSLGSLVVATSGLAIPAWIFGKKARHRFSQH
NLLA