Protein Info for mRNA_5426 in Rhodosporidium toruloides IFO0880

Name: 13794
Annotation: K06944 K06944 uncharacterized protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 368 TIGR00231: small GTP-binding protein domain" amino acids 66 to 215 (150 residues), 86.7 bits, see alignment E=7.7e-29 PF01926: MMR_HSR1" amino acids 66 to 168 (103 residues), 66.1 bits, see alignment E=6.1e-22 PF02421: FeoB_N" amino acids 67 to 168 (102 residues), 33.9 bits, see alignment E=4.6e-12 PF16897: MMR_HSR1_Xtn" amino acids 186 to 289 (104 residues), 140.7 bits, see alignment E=3.4e-45 PF02824: TGS" amino acids 292 to 366 (75 residues), 57.1 bits, see alignment E=3.1e-19

Best Hits

Swiss-Prot: 62% identical to DRG2_MOUSE: Developmentally-regulated GTP-binding protein 2 (Drg2) from Mus musculus

KEGG orthology group: K06944, (no description) (inferred from 68% identity to scm:SCHCODRAFT_64754)

Predicted SEED Role

"GTP-binding protein RBG2"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (368 amino acids)

>mRNA_5426 K06944 K06944 uncharacterized protein (Rhodosporidium toruloides IFO0880)
MGVLEKIRDIEQEMARTQKNKATEYHLGLLKAKLARYRAELLEGQSAKSGGKGEGFDVAK
SGYGRAVLIGFPSVGKSTLLSKVTNTESVAAAYAFTTLVAVPGVLDCEGAKVQLLDLPGI
IEGASSGRGRGRQVVAVAKTADLVVMMLDVTKGDEQRQQLEHELEEIGIRLNRSKPDVVF
KAKTAGGITINSTVPLTRTDERTIRGILQAYKIHNADVMIREDISTDDLIDVILGNRKYV
PCLYVYNKIDSISLEEVDRLARLPHTMVMSCELDLNLEVFKRRVWEKMGFNRVYTKKRGE
EPDLGDPLVIKTDATMEAVCDSVHRGIKNKFKYAVVWGKSSKFAPRPQKVGLTHRCAQDD
VVSIVTNV