Protein Info for mRNA_5444 in Rhodosporidium toruloides IFO0880

Name: 13812
Annotation: HMMPfam-Eukaryotic cytochrome b561-PF03188,ProSiteProfiles-Cytochrome b561 domain profile.-PS50939,SMART-Cytochrome b-561 / ferric reductase transmembrane domain.-SM00665

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 227 transmembrane" amino acids 21 to 44 (24 residues), see Phobius details amino acids 54 to 73 (20 residues), see Phobius details amino acids 93 to 111 (19 residues), see Phobius details amino acids 131 to 151 (21 residues), see Phobius details amino acids 171 to 190 (20 residues), see Phobius details amino acids 203 to 224 (22 residues), see Phobius details PF03188: Cytochrom_B561" amino acids 56 to 192 (137 residues), 53.5 bits, see alignment E=1.5e-18

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (227 amino acids)

>mRNA_5444 HMMPfam-Eukaryotic cytochrome b561-PF03188,ProSiteProfiles-Cytochrome b561 domain profile.-PS50939,SMART-Cytochrome b-561 / ferric reductase transmembrane domain.-SM00665 (Rhodosporidium toruloides IFO0880)
MGRSDTQGVTPSALQVVGRNSAGGVAAVVVQLGLIVSNAVLWRVLYTHPAGLFTYHPSFQ
SLAVLGFLEGILLLQPQPPNAAYKRKGLQLHQVVQYTSCAAIVAGAAFIVYNKVAHGAKH
FTTWHAKSGLVTLTLIFLQISFGAVIVYTPLQRLIFRGEDRAKKLWKYHRMSGYLTLFFL
ILTPLLALASDWVRQNSSSAERWVVGVGLAVAGVGALGRVQCVLLRS