Protein Info for mRNA_5456 in Rhodosporidium toruloides IFO0880

Name: 13824
Annotation: K07034 K07034 uncharacterized protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 318 transmembrane" amino acids 82 to 100 (19 residues), see Phobius details amino acids 112 to 130 (19 residues), see Phobius details amino acids 158 to 178 (21 residues), see Phobius details amino acids 187 to 210 (24 residues), see Phobius details amino acids 220 to 241 (22 residues), see Phobius details amino acids 247 to 269 (23 residues), see Phobius details amino acids 276 to 297 (22 residues), see Phobius details PF01184: Gpr1_Fun34_YaaH" amino acids 70 to 105 (36 residues), 43.8 bits, see alignment 1.2e-15 amino acids 147 to 315 (169 residues), 212.4 bits, see alignment E=2.9e-67

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (318 amino acids)

>mRNA_5456 K07034 K07034 uncharacterized protein (Rhodosporidium toruloides IFO0880)
MASTTGSSLHNGADVEKTAGVNHAANGAHGQHGVTGVSTGSPAYASQEGGAPFNLRNITP
GGHPLDRSQPAFPTYHRRFANPAPLGLCGFALTTFMLSLINGKSRRSERDPLGRVTSAFA
VLRLVVAASTSDERVEQHTDSEDDALAVKTRGVTVPNVVVGPALFYGGLAQLLAGMWEFA
TGNTFGATAFSSYGAFWLAYAFIVSPWSAIASSYEAEGMFGNGVAFFLWGWFIFTFIMLL
ASLRSSIALTGVFFFLTITFLLLGIAELGVGNASAIQTAGGAFGLITAFNAWYVAAANLM
TPDQSFFVLPVGDMSKKD