Protein Info for mRNA_5479 in Rhodosporidium toruloides IFO0880

Name: 13847
Annotation: KOG3070 Predicted RNA-binding protein containing PIN domain and invovled in translation or RNA processing

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 273 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF00098: zf-CCHC" amino acids 77 to 88 (12 residues), 21.1 bits, see alignment (E = 2.5e-08) amino acids 94 to 111 (18 residues), 32.5 bits, see alignment (E = 6.3e-12) amino acids 134 to 150 (17 residues), 31.3 bits, see alignment (E = 1.6e-11) PF13917: zf-CCHC_3" amino acids 93 to 112 (20 residues), 12 bits, see alignment (E = 1.7e-05) amino acids 132 to 150 (19 residues), 11 bits, see alignment (E = 3.6e-05)

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (273 amino acids)

>mRNA_5479 KOG3070 Predicted RNA-binding protein containing PIN domain and invovled in translation or RNA processing (Rhodosporidium toruloides IFO0880)
MVVVALLSLAKHVLPPTRAILLVSCCLSCTPCCSTTARPHRHCLPHRRHSPVLQRAFPFL
SFDSRSEAYLVATRLQCGQPGHISRECSNAAAPKKCYNCGDSGHISRECPQNPNAGAGGF
GGQGAGFGGAGAGVCYRCGQPGHISRACPQNFAGAGAGCASHSFLSSTSARLMNLCERSQ
SAVDSAADSADPATAPRRATRAVVSATSRASASTPPSASTADSRDTSRATAPSLPARSRA
TTAARPATSRATAPPPAAPLPPPKRLPLLPLCA