Protein Info for mRNA_5526 in Rhodosporidium toruloides IFO0880

Name: 13894
Annotation: K00052 leuB 3-isopropylmalate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 378 TIGR00169: 3-isopropylmalate dehydrogenase" amino acids 5 to 369 (365 residues), 455.4 bits, see alignment E=6.3e-141 PF00180: Iso_dh" amino acids 5 to 367 (363 residues), 392.1 bits, see alignment E=1.2e-121

Best Hits

Swiss-Prot: 56% identical to LEU3A_ASPNG: 3-isopropylmalate dehydrogenase A (leu2A) from Aspergillus niger

KEGG orthology group: K00052, 3-isopropylmalate dehydrogenase [EC: 1.1.1.85] (inferred from 65% identity to mgl:MGL_0905)

Predicted SEED Role

"3-isopropylmalate dehydrogenase (EC 1.1.1.85)" in subsystem Branched-Chain Amino Acid Biosynthesis or Leucine Biosynthesis (EC 1.1.1.85)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.85

Use Curated BLAST to search for 1.1.1.85

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (378 amino acids)

>mRNA_5526 K00052 leuB 3-isopropylmalate dehydrogenase (Rhodosporidium toruloides IFO0880)
MPYFITCLAGDGIGPEVSAQAIRVLETFSAHTDLKFEVASHDFGGIAIDNHQNPLPESTL
KACQEADAILLGAVGGPKWGTHPTLRPEIGLLALRKALGLYANIRPASFPAPSLVAHSPL
KEHIAQGTDIVVVRELIGGIYFGERREAVAGATEGKDAEAYDACTYSVPEVQRITRLAAY
LAKCSNPPLAIHSVDKANVLATSRLWRRVVQETLDKEAPELKLDHQLVDSAAMLICANPR
KLNGIVLTENLFGDILSDETSVIPGSLGLLPSASLGGIPDGTSRIPGLYEPIHGSAPDIA
GQNIANPIGTILSVALMLRYSFGKEREAKLVEEAVRIVLDDESAGGCGFRTKDLGGDKTT
TQVGDKVVEVLTGLLSKK