Protein Info for mRNA_5567 in Rhodosporidium toruloides IFO0880

Name: 13935
Annotation: K14394 ACP1 low molecular weight phosphotyrosine protein phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01451: LMWPc
  • amino acids 4 to 145 (142 residues), 156.8 bits, E=2.4e-50

Best Hits

Swiss-Prot: 50% identical to PPAL_SCHPO: Low molecular weight phosphotyrosine protein phosphatase (stp1) from Schizosaccharomyces pombe (strain 972 / ATCC 24843)

KEGG orthology group: K14394, low molecular weight phosphotyrosine protein phosphatase [EC: 3.1.3.2 3.1.3.48] (inferred from 59% identity to lbc:LACBIDRAFT_243421)

Predicted SEED Role

"Low molecular weight protein tyrosine phosphatase (EC 3.1.3.48)" in subsystem LMPTP YfkJ cluster or LMPTP YwlE cluster (EC 3.1.3.48)

MetaCyc Pathways

• phosphate acquisition (1/1 steps found)

KEGG Metabolic Maps

• Riboflavin metabolism
• gamma-Hexachlorocyclohexane degradation

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.2

Use Curated BLAST to search for 3.1.3.2 or 3.1.3.48

Protein Sequence (158 amino acids)

>mRNA_5567 K14394 ACP1 low molecular weight phosphotyrosine protein phosphatase (Rhodosporidium toruloides IFO0880)
MPSVLFVCLGNICRSPLAEAVFADMVKKRGFGDDFTVDSAGTAGYHVGEEPDERSVEVCR
RHGVPVDSVCRQLEKADFTRFDYIIGMDSMNMSNIEKAKPANSTAKIALFGSFGDGKVIQ
DPYYGGKDGFEKTYKQCVRYSEGLLKAMGYDDASGGKL