Protein Info for mRNA_5587 in Rhodosporidium toruloides IFO0880

Name: 13955
Annotation: KOG0255 Synaptic vesicle transporter SVOP and related transporters (major facilitator superfamily)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 573 transmembrane" amino acids 119 to 142 (24 residues), see Phobius details amino acids 157 to 175 (19 residues), see Phobius details amino acids 187 to 206 (20 residues), see Phobius details amino acids 212 to 234 (23 residues), see Phobius details amino acids 246 to 267 (22 residues), see Phobius details amino acids 279 to 298 (20 residues), see Phobius details amino acids 361 to 381 (21 residues), see Phobius details amino acids 401 to 421 (21 residues), see Phobius details amino acids 442 to 461 (20 residues), see Phobius details amino acids 468 to 489 (22 residues), see Phobius details amino acids 500 to 525 (26 residues), see Phobius details amino acids 533 to 558 (26 residues), see Phobius details PF07690: MFS_1" amino acids 128 to 521 (394 residues), 119.6 bits, see alignment E=1.6e-38 PF00083: Sugar_tr" amino acids 152 to 341 (190 residues), 50.5 bits, see alignment E=1.6e-17

Best Hits

KEGG orthology group: None (inferred from 50% identity to pcs:Pc12g14890)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (573 amino acids)

>mRNA_5587 KOG0255 Synaptic vesicle transporter SVOP and related transporters (major facilitator superfamily) (Rhodosporidium toruloides IFO0880)
MPAAPEPYIPEASQAPERGAQVPPLVDPPSRESATSTSSGDTQGSTVGGDDGRSAVATLH
EADEEAAGRPGGGEKDLEKGATRRDSKGSSSDGGVIVVGWKGDDDPECPLNWPKSRRMLA
TVCVAGFTLLAPLSSSAMAPAALQVAQKLHITNEVEIQMSTSIFVLAFAISPLVFGPASE
LFGRIRVLQLANVLYLIFNLVCAFATTKSQFIAFRFFAGFGGGAPLAIGAGVLSDLWRPE
ERGKGAALYSLGPLLGPALGPVIGGWIVQCLPNDGYKWIFWSTTIFSGFIQLLGLIGLRE
TYAPILLRNKAAALKKSMGLPHDSDHVQTSYEVKAGGRRKTPREVVVHGMLRPFALLAYE
PILQLFALYLAVIYGCIYLLLTTMSQLYEGTYGQSTGIASLHYIALALGFMIASQGGARL
LDVIYRRLKAREHGPGRPEFRLPLVVPASISLPFGLLLYGWSAEHRLHWIVPDIGLVFIG
LGMILVFQASTSYLIDTFTLHAASALAASVCLRSICGFAFPLFAPYMFDGIGYGWGCTIL
AVVTIIVGCPAAPLLYIFGERIRGMSRNAAKGK