Protein Info for mRNA_5594 in Rhodosporidium toruloides IFO0880

Name: 13962
Annotation: K07943 ARL2 ADP-ribosylation factor-like protein 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 236 PF00025: Arf" amino acids 4 to 165 (162 residues), 201.5 bits, see alignment E=2.2e-63 PF09439: SRPRB" amino acids 27 to 147 (121 residues), 25 bits, see alignment E=3.5e-09 TIGR00231: small GTP-binding protein domain" amino acids 27 to 149 (123 residues), 57.5 bits, see alignment E=6.9e-20 PF04670: Gtr1_RagA" amino acids 27 to 155 (129 residues), 33.2 bits, see alignment E=1.1e-11 PF01926: MMR_HSR1" amino acids 27 to 127 (101 residues), 28.6 bits, see alignment E=4e-10 PF08477: Roc" amino acids 28 to 132 (105 residues), 39.1 bits, see alignment E=2.5e-13 PF00071: Ras" amino acids 29 to 141 (113 residues), 29.3 bits, see alignment E=1.9e-10

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (236 amino acids)

>mRNA_5594 K07943 ARL2 ADP-ribosylation factor-like protein 2 (Rhodosporidium toruloides IFO0880)
MGLLTIIRKARLKEKQVRILMLYAGRGLDNAGKTTICKAILGEDVEEVSPTLGFNIRTIV
HQGFTLNVWDIGGQTSLRPYWRNYFEQTDAVLWVVDSSDRARMEDCRRELHELLKEERLV
GASLLVFANKQDIANAMTVDEISSALELSTLSSSHHWTIQPCSARYARLAASPLTSSDSP
AAPAFPATPPASAAKVDPRIMKGLDWVVAEVGSRVYYGVQNSAVAPDAVRPVAQAA