Protein Info for mRNA_5601 in Rhodosporidium toruloides IFO0880

Name: 13969
Annotation: K15014 SLC29A1_2_3, ENT1_2_3 solute carrier family 29 (equilibrative nucleoside transporter), member 1/2/3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 553 transmembrane" amino acids 110 to 130 (21 residues), see Phobius details amino acids 150 to 170 (21 residues), see Phobius details amino acids 182 to 200 (19 residues), see Phobius details amino acids 211 to 234 (24 residues), see Phobius details amino acids 249 to 271 (23 residues), see Phobius details amino acids 313 to 335 (23 residues), see Phobius details amino acids 376 to 399 (24 residues), see Phobius details amino acids 416 to 434 (19 residues), see Phobius details amino acids 446 to 467 (22 residues), see Phobius details amino acids 483 to 507 (25 residues), see Phobius details amino acids 519 to 542 (24 residues), see Phobius details PF01733: Nucleoside_tran" amino acids 355 to 543 (189 residues), 104.1 bits, see alignment E=4.9e-34

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (553 amino acids)

>mRNA_5601 K15014 SLC29A1_2_3, ENT1_2_3 solute carrier family 29 (equilibrative nucleoside transporter), member 1/2/3 (Rhodosporidium toruloides IFO0880)
MFAPAAPLARAVSKARTAASQTASEIQSDIHVAERLYAEATHPQDEGQEVPEELDADEAE
EVIDEEYRPLMEGEEGEEGQGGEASGKATKGKRKRWDEEGGETKVRKFEVWLAQLIFFIL
GACILLSWNTEIVAGAYFGARLVGSPFQTSFASFVALTFTTANLAFLAHANATQGGANLS
RRIQISIVTLILILVIFIVSTQVKEIPANLFFAYLIVSAVILAASASYLQNAVVALSASF
GPRFLNQILSGQGAIAFAVAGIQFAAAYGAVKNQKPKSPSSAFRLQADYTLSDPHLVADL
ATAVPPPAVRQTAFTFFLTVGIFAAVSLVSYWLLLRLPLYRLVIRASFDEDAATTKSKQA
ASSTSLRVVERKVRHLGIAMFLIFAVTLAVFPSITATIVSVKTGEPDVKLFQRPELFVPL
GFAVFAAGDWLGRVMPQWEKLAWTNWKILMGISVARLVFVPLFLMCNQTAGGAGRAIIRS
DVAFFLIMFAFAISNGYISTLIMLASVVEPSLEQEEIEVAATCLAFYLTAGLSAGSFLSF
AVRAAICRCNPFV