Protein Info for mRNA_5627 in Rhodosporidium toruloides IFO0880

Name: 13995
Annotation: K10756 RFC3_5 replication factor C subunit 3/5

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 368 transmembrane" amino acids 293 to 310 (18 residues), see Phobius details PF13177: DNA_pol3_delta2" amino acids 31 to 182 (152 residues), 40 bits, see alignment E=3.7e-14 PF00004: AAA" amino acids 38 to 178 (141 residues), 33.1 bits, see alignment E=7.1e-12

Best Hits

Swiss-Prot: 52% identical to RFC5_SCHPO: Replication factor C subunit 5 (rfc5) from Schizosaccharomyces pombe (strain 972 / ATCC 24843)

KEGG orthology group: K10756, replication factor C subunit 3/5 (inferred from 52% identity to mdo:100020774)

Predicted SEED Role

"Replication factor C small subunit" in subsystem DNA replication, archaeal

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (368 amino acids)

>mRNA_5627 K10756 RFC3_5 replication factor C subunit 3/5 (Rhodosporidium toruloides IFO0880)
MALWVDRYRPRSLGDLDYHPELSDRLRALAEGDFPHTLFYGPSGAGKKTRIMATLRELFG
PGVEKIRIEQRSFLTPSKRKLDVNIVQSNYHIEITPSDVGNYDRSVVQEVLKDIAQTQQV
DLNAKKRFKVVIINEADGLSRDAQSALRRTMEKFTSSLRVILCANSTSKIIGPIRSRCLL
LRVGAPSEEQICKVLQSVAKQESVGVPDHVATLVSRISYGNLRRAILSLEALHTQDPSFK
TIKPDHSLLSTGKQDARDIDAVPRPDWEKYAAKAAERILSEQSPESLLAVRGMFYELLVH
CIPAPLILATITRRLLDRVDEDLKADVAYWSAFYDHRLRQGSKHIFHLEAFAAKIMTIHK
QHSLGFTE