Protein Info for mRNA_5691 in Rhodosporidium toruloides IFO0880

Name: 14059
Annotation: K05956 RABGGTB geranylgeranyl transferase type-2 subunit beta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 324 transmembrane" amino acids 45 to 58 (14 residues), see Phobius details PF00432: Prenyltrans" amino acids 63 to 104 (42 residues), 32.4 bits, see alignment 3.1e-12 amino acids 111 to 154 (44 residues), 44.7 bits, see alignment 4.6e-16 amino acids 161 to 202 (42 residues), 34.4 bits, see alignment 7.2e-13 amino acids 210 to 250 (41 residues), 46.7 bits, see alignment 1.1e-16 amino acids 255 to 299 (45 residues), 34 bits, see alignment 1e-12

Best Hits

Swiss-Prot: 54% identical to PGTB2_MOUSE: Geranylgeranyl transferase type-2 subunit beta (Rabggtb) from Mus musculus

KEGG orthology group: K05956, geranylgeranyl transferase type-2 subunit beta [EC: 2.5.1.60] (inferred from 61% identity to cci:CC1G_04781)

Predicted SEED Role

No annotation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.60

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (324 amino acids)

>mRNA_5691 K05956 RABGGTB geranylgeranyl transferase type-2 subunit beta (Rhodosporidium toruloides IFO0880)
MATTQAEAAPQTLLTDLHVSYIQSLDKDQDSLSYLFTEHLRMNGVYWGLTALAFMGRMDA
LPRDEMIRWVMSCWHEDVGGFAPHPGHEPHIHSTLSAVQILAMQDSLDVLNKDKIVAWVL
SLQDPKRGSFAGDEWGEQDSRFSCCAVGILALLGRLDDLDKEVTVDFIRNCRNFDGGFGR
VEGAESHASYVWTSVSTLAMLDRLDIVDSDTLCWWLCERQLPNGGLNGRPEKLEDVCYSW
WVIATLAILGRSHWIDGAKLTKFILSAQDPDKGGIADRPEDVADVWHTVFGLAGLALLDY
PGLQAVDPRLCMPLSVTDKLLKKQ