Protein Info for mRNA_5725 in Rhodosporidium toruloides IFO0880

Name: 14093
Annotation: K03234 EEF2 elongation factor 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 886 PF00009: GTP_EFTU" amino acids 62 to 388 (327 residues), 220.5 bits, see alignment E=4.7e-69 TIGR00231: small GTP-binding protein domain" amino acids 64 to 208 (145 residues), 67.4 bits, see alignment E=6.3e-23 PF01926: MMR_HSR1" amino acids 71 to 203 (133 residues), 23.1 bits, see alignment E=1.9e-08 PF03144: GTP_EFTU_D2" amino acids 438 to 514 (77 residues), 44.6 bits, see alignment E=4.6e-15 PF14492: EFG_II" amino acids 530 to 592 (63 residues), 47.7 bits, see alignment 4.1e-16 PF03764: EFG_IV" amino acids 653 to 764 (112 residues), 99.3 bits, see alignment E=4e-32 PF00679: EFG_C" amino acids 768 to 853 (86 residues), 74.2 bits, see alignment E=2.1e-24

Best Hits

Swiss-Prot: 78% identical to EF2_CANAW: Elongation factor 2 (EFT2) from Candida albicans (strain WO-1)

KEGG orthology group: K03234, elongation factor 2 (inferred from 81% identity to cci:CC1G_00516)

Predicted SEED Role

"Translation elongation factor 2" in subsystem Translation elongation factor G family or Translation elongation factors eukaryotic and archaeal or Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (886 amino acids)

>mRNA_5725 K03234 EEF2 elongation factor 2 (Rhodosporidium toruloides IFO0880)
MRLQVAERALVVKSFPLTARPSACCPRSSLLPRPEQPQARQSPAMVNFTVDEIRGLMDKP
TNVRNMSVIAHVDHGKSTLTDSLLSKAGIIASAKAGDTRAMDTRADEQERGITIKSTAIS
MYFELPKEDLTDVKQKTDGGEFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDTIDGVC
VQTETVLRQALGERIKPVVCINKVDRALLELQIAKEELYQTFARTIESVNVIISMYKEES
LGDVQVYPEAGTVAFASGLHGWAFTLRQFAKRYAKKFGVSQDKLMPKLWGDNYFNPKTKK
WSTKAVDADGKPLERGFNMFVLDPIFRIFDAVMNFKKDQIPGLLEKLEINLTSDEKDLEG
KALLKVIMRKFLPAGDSLLEMVVIHLPSPVTAQRYRVETLYEGPMDDESAIAIRDCDAKG
PLMLYVSKMVPTSDKGRFYAFGRVFSGTVKAGPKIRIQGPNYVPGKKDDLFVKSIQRTVL
MMGGKVDPLEDCPAGNIVGLVGVDQFLLKSGTLTTSETAHNMRVMKFSVSPVVQVAVEVK
NANDLPKLVEGLKRLSKSDPCVQTWIAETGEHIVAGAGELHLEICLKDLVEDHAGVPLKL
SDPVVGYRETVQAESSMTALSKSQNKHNRLYVKAQPVDEEVAKAVESGKIGPRDDFKARA
RILADEFGWDVTDARKIWCFGPDGSGPNFLVDTTKGVQYLNEIKDSCVAAFQWATKEGPC
AEEPMRCSRYNILDVTLHTDAIHRGGGQIIPTCRRVVYAASLLAEPGLQEPVYQVEIQCP
ETALGGIYSTLNRKRGMVFSEEQRPGTPMYTVKAYLPVNESFGFTGELRQATGGQAFPQM
VFDHWQTMGGAITEKGGKVEALALSIRTRKGLKPEIPSLDNFYDKL