Protein Info for mRNA_5819 in Rhodosporidium toruloides IFO0880

Name: 14187
Annotation: K10761 THG1 tRNA(His) guanylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04446: Thg1
  • amino acids 6 to 139 (134 residues), 151.6 bits, E=1.1e-48
• PF14413: Thg1C
  • amino acids 144 to 287 (144 residues), 146.5 bits, E=4.5e-47

Best Hits

KEGG orthology group: K10761, tRNA(His) guanylyltransferase [EC: 2.7.7.-] (inferred from 54% identity to act:ACLA_020800)

Predicted SEED Role

"tRNAHis-5'-guanylyltransferase" in subsystem tRNA processing

KEGG Metabolic Maps

• Biosynthesis of siderophore group nonribosomal peptides
• Lipopolysaccharide biosynthesis
• Nucleotide sugars metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.-

Use Curated BLAST to search for 2.7.7.-

Protein Sequence (303 amino acids)

>mRNA_5819 K10761 THG1 tRNA(His) guanylyltransferase (Rhodosporidium toruloides IFO0880)
MAGSRYTYVKGFELPDPLLPSTFFVIRIDGKGFHGFSKAHNFDKPNDWNALTLMNEAAKR
VVGGRELNGECVMAFGESDEYSFVFKRSCKLHGRRSSKLVTLVVSVFTAAYVALWPHYFP
NSPLKFEELPVFDGRVVQYTNEAEVRDYLRWRQVDTHINNMYNTVFWTLVLQGGRTPIEA
EQELSGTVSSQKQEILFSQFGINYNNLEPMYRKGSLVIWEEEPPAENAPASTDEPSTASS
SASPSPASAQTANSLSIDSTLAPVKMRQRKKPAKPKRRLVVVHEDLISDAWWESGRGKGL
LEG