Protein Info for mRNA_5829 in Rhodosporidium toruloides IFO0880

Name: 14197
Annotation: K00228 CPOX, hemF coproporphyrinogen III oxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 471 transmembrane" amino acids 99 to 119 (21 residues), see Phobius details PF01218: Coprogen_oxidas" amino acids 162 to 470 (309 residues), 425.5 bits, see alignment E=3.8e-132

Best Hits

Predicted SEED Role

"Coproporphyrinogen III oxidase, aerobic (EC 1.3.3.3)" in subsystem Experimental tye or Heme and Siroheme Biosynthesis (EC 1.3.3.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.3.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (471 amino acids)

>mRNA_5829 K00228 CPOX, hemF coproporphyrinogen III oxidase (Rhodosporidium toruloides IFO0880)
MRPRDAVDAALRQPASAFVRRLCPARLCVLPLFAMLRNSSTAHGALRRASLSSAPTARLH
SFPSSSASLPIIPPPRSSRAHSSFTSWNPHTTHSHRSRFLMTVSVAAGLAAATAAFSLYK
SPLDPLDCEEQRPMSAQRGRPSFVPTPSVDLDDTSIPMRLRMIHHIKSLQSTICEALESL
EPSGQKFKSSYYLRDASKGFGDSRVLQDGETFEKAGCNISVIKSTLSVPAVRQMRAERFD
WWDGVSELPYFVAGCSLVVHPRNPHAPTIHFNYRYFEIQDPKDPNGEPKAWWFGGGTDLT
PSYLYEDDARHFHGLYKEACDRHAAGYYARFKKWCDEYFYIPHRQESRGIGGIFFDDLSE
GDPEAIFKFVRDCSNSYLPAYYPIVERRKDQPFTEEEKRWQQLRRGRYVEFNLVYDRGTK
FGLAMKEPRTESILMSLPLTSRWEYEPEVGTIEGSREKKILDILKKPVEWA