Protein Info for mRNA_5853 in Rhodosporidium toruloides IFO0880

Name: 14221
Annotation: K15378 SLC45A1_2_4 solute carrier family 45, member 1/2/4

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 900 950 981 transmembrane" amino acids 34 to 51 (18 residues), see Phobius details amino acids 71 to 94 (24 residues), see Phobius details amino acids 106 to 124 (19 residues), see Phobius details amino acids 142 to 162 (21 residues), see Phobius details amino acids 185 to 208 (24 residues), see Phobius details amino acids 220 to 240 (21 residues), see Phobius details amino acids 281 to 303 (23 residues), see Phobius details amino acids 337 to 358 (22 residues), see Phobius details amino acids 396 to 418 (23 residues), see Phobius details amino acids 428 to 450 (23 residues), see Phobius details amino acids 836 to 857 (22 residues), see Phobius details amino acids 937 to 959 (23 residues), see Phobius details PF13347: MFS_2" amino acids 63 to 250 (188 residues), 30.7 bits, see alignment E=6.7e-12

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (981 amino acids)

>mRNA_5853 K15378 SLC45A1_2_4 solute carrier family 45, member 1/2/4 (Rhodosporidium toruloides IFO0880)
MVGLGAASQSASRGRSRWVGRAGVLSHRPLLPEWVRFLALTVSLLGLQLVWSCEMSQASP
FLLSLGVSKSMMSVVFLAGPLSGLIVQPLVGVLSDGCKSSLGRRRPFIIGGCVLTSLSVL
MLGWSKEIAGVFAKDGTSLHNHLAIACAVVSVYVIDFSVNVVQAMDRSLLVDVVSPAQQP
AANAWAGRMFGFGAVFGYWIGGVDLVWFTRGLLGDQQLKVLTIFTSFFLCGTHAITCSCV
QERILISRDDEHEASGGGPMRALEDIWQTIKTLPRPIRQVFNVQFTGWIGWFPILFFSTT
WVAEIYVKSHATSGATDLASASEEMRAAATRAGTHAMLWHSVVSLATSILLPPLVATASS
SSATPQNDRSRSPYGGRSSSSPLDVIKRALPSVPFTWLSLPLLWAISNGFFAFLLFGGTW
MVSSVGGASFIIAAAGFSWAVTNWAPFALLGELILRIGSSPHPLSTLSPNNSTIMLQPNP
SSTHFRLSSGSDGEDDASTGLNDKHALAHSPKRNRAHPPRDLDITPTPPARFSRFGEQVG
RDDEFPTTPTTARSFYFDAASAGEESDSERMRLDDETMSRSTSDNSFRSTNSGPQLGSPS
TTGSRTPTLSASPSFTSDRLNESQGSTRRNSFESAKSGSTIAFPPNHGSVGVNLFDADEE
GGGFPRGKGGRLSQEFYSADPYAYGGRSALASPYGRGGKGSESTIHLPRRGSVQKGTYGG
APGVDSDGEADGHDSSRVLQIRHSDSFDLDEAERDSFDFADGPGGRGHLEVGGQRSNSVS
PALGRNGGSPTPRIVVEGEEGQEDEWQAEGAEDGSDAGNVAGGGDQTGVILGCHNIFLVL
PQFLVTALSSIIFAILAPHHSVLPAHHTTIAPPNTNLTTAANPSSTIASIDDIDAVGTNE
FASLAVRAVAAVGRAFVERRQEAGEDLPPGGQAGWDAIGLIFRIGGISAAFSTYICFQMW
RDKVRAEKRARATSRGYRLGV