Protein Info for mRNA_5856 in Rhodosporidium toruloides IFO0880

Name: 14224
Annotation: K03357 APC10, DOC1 anaphase-promoting complex subunit 10

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 182 PF03256: ANAPC10" amino acids 8 to 176 (169 residues), 182.7 bits, see alignment E=3e-58

Best Hits

KEGG orthology group: K03357, anaphase-promoting complex subunit 10 (inferred from 49% identity to lbc:LACBIDRAFT_297341)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (182 amino acids)

>mRNA_5856 K03357 APC10, DOC1 anaphase-promoting complex subunit 10 (Rhodosporidium toruloides IFO0880)
MAEPTADELRDIGSLAHWAVSSAKPGYGVEHVRDADPATLWQSEGAQPHLINIQFPKKQS
ISQVWIFADINQDDSYTPHKISIRAGTHHGDLHEVRWIELANPRGWQAFRLGGSSKTGDT
GPAEGEEPIRAHLLQIAILSNHMNGKDTHVRGVRIFAPRALELDDDLVPFRTVAFTQHET
IR