Protein Info for mRNA_5862 in Rhodosporidium toruloides IFO0880

Name: 14230
Annotation: K14998 SURF1, SHY1 surfeit locus 1 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 309 transmembrane" amino acids 67 to 87 (21 residues), see Phobius details amino acids 272 to 293 (22 residues), see Phobius details PF02104: SURF1" amino acids 75 to 284 (210 residues), 148.3 bits, see alignment E=1.5e-47

Best Hits

Predicted SEED Role

"Cytochrome oxidase biogenesis protein Surf1, facilitates heme A insertion" in subsystem Biogenesis of cytochrome c oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (309 amino acids)

>mRNA_5862 K14998 SURF1, SHY1 surfeit locus 1 family protein (Rhodosporidium toruloides IFO0880)
MFRTALGAGLRSAPRARAPAPPSPFPSVSARSAPRSARLPSTPFASIRHASSTSFSQSAR
DKLRARPFLLLVGLMPVFTFGLGVWQIKRLNWKVDLIHQLDDKLHQPPVRLPARIDTAAI
PEFAWRKVFVTGTLDHEHSIELGPKTRDGQLGYHVVTPLVRGEGQDTILVNRGFVKREFK
EAKDRPASLTNEPVALVGMLRDQEAPNSFTPVNQPEKDQWVFANIAEMARYTGAEPVLVD
QIYDDHPGKVDLLLREGIPVGRSASIELRNMHATYAATWFSLSLATAFMFWRLMRRPSVL
TTAQYRGVK