Protein Info for mRNA_5873 in Rhodosporidium toruloides IFO0880

Name: 14241
Annotation: K00761 upp, UPRT uracil phosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 68% identical to UPP_YEAST: Uracil phosphoribosyltransferase (FUR1) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

KEGG orthology group: K00761, uracil phosphoribosyltransferase [EC: 2.4.2.9] (inferred from 74% identity to uma:UM03873.1)

MetaCyc: 68% identical to uracil phosphoribosyltransferase (Saccharomyces cerevisiae)
Uracil phosphoribosyltransferase. [EC: 2.4.2.9]

Predicted SEED Role

"Uracil phosphoribosyltransferase (EC 2.4.2.9)" in subsystem De Novo Pyrimidine Synthesis or LMPTP YwlE cluster (EC 2.4.2.9)

MetaCyc Pathways

pyrimidine nucleobases salvage II (2/2 steps found)
pyrimidine nucleobases salvage I (1/1 steps found)
superpathway of pyrimidine nucleobases salvage (3/4 steps found)
superpathway of pyrimidine ribonucleosides salvage (7/10 steps found)

KEGG Metabolic Maps

Pyrimidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.4.2.9

Use Curated BLAST to search for 2.4.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (227 amino acids)

>mRNA_5873 K00761 upp, UPRT uracil phosphoribosyltransferase (Rhodosporidium toruloides IFO0880)
MASLPAHLASAPSDLPPNACPLPRSGQLAGLLTSIRDKNTNRGDFIFYSDRIIRLLVEEG
LNHLPVVEKTVTTPTGLDYKGVGFEGKICGVSIMRAGESMEAGLRECCRAVRIGKILIQR
DEETAQAKLFYAKLPDDIANRYCLLLDPMLATGGSAIKAIEVLIDHGVPQERIIFLNLVS
CPEGLQAMYDVYPQVKIVTAWVDEKLNEQKYIVPGLGDFGDRYFTSN