Protein Info for mRNA_5878 in Rhodosporidium toruloides IFO0880

Name: 14246
Annotation: KOG4210 Nuclear localization sequence binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 581 PF00076: RRM_1" amino acids 153 to 224 (72 residues), 32 bits, see alignment E=4.5e-12 amino acids 407 to 442 (36 residues), 23.5 bits, see alignment 2e-09

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (581 amino acids)

>mRNA_5878 KOG4210 Nuclear localization sequence binding protein (Rhodosporidium toruloides IFO0880)
MASDAALEIDTAPLAADHANEAAPAVKKSKGKGKAKDGSKKRKANDADDDAAPASAGTAP
DSHSEANGAAHEVKEADGEGAGEDDDERPLSRKERRQAKKRKLAADAAGDDELLPPSKPA
KSSTSTSTSQPTAPTSIGSTLVGNTPSRSAHGVWVGNLNFATHPRELLQWFKERGLEEVT
RINMPGGKRQHENNRGFAYLDFPSATDVTIAVGLSEQHLDGRKLLIKSSTDYTGRPAPAA
STSTSAAGAGAGTVKDVLSTLDSSALERPHPSAPAATTGEAPATLNRTARKILSRQKNPA
GPTLFLGNLGFETTVEDIRDMFDRNQRRGREWAKGGVEEDEEEGAEKEGEAEEKKEEEAS
EAEDGEEKPKSDKKREQKKKREKGAPLDLAKAKDAGIRKVRLGTFEDSGKCKGWAFVDFH
LPAQATRALLNLHNHQLNGRKLNVEYASAEAVRRGAVGTKSGGGGGGRGIAGPRRRGPRE
EGEEGEEGYEERGAGGKKRREREWDDTDVKALAAQAGGETGYGGPPPRAQRGPRPQRDDA
RKGGREDGGGAKRPKPGAALAMAQRASEGIVQSTGKKITFD