Protein Info for mRNA_5889 in Rhodosporidium toruloides IFO0880

Name: 14257
Annotation: K02977 RP-S27Ae, RPS27A small subunit ribosomal protein S27Ae

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 154 PF11976: Rad60-SLD" amino acids 1 to 71 (71 residues), 57.8 bits, see alignment E=3.3e-19 amino acids 77 to 147 (71 residues), 57.8 bits, see alignment E=3.3e-19 PF00240: ubiquitin" amino acids 3 to 74 (72 residues), 116.5 bits, see alignment E=1.4e-37 amino acids 79 to 150 (72 residues), 116.5 bits, see alignment E=1.4e-37 PF13881: Rad60-SLD_2" amino acids 11 to 71 (61 residues), 14.3 bits, see alignment E=1.5e-05 amino acids 86 to 147 (62 residues), 14.4 bits, see alignment E=1.4e-05 PF14560: Ubiquitin_2" amino acids 13 to 69 (57 residues), 22.3 bits, see alignment E=5.9e-08 amino acids 88 to 145 (58 residues), 22.4 bits, see alignment E=5.4e-08

Best Hits

Swiss-Prot: 99% identical to UBIQP_HORVU: Polyubiquitin (Fragment) from Hordeum vulgare

KEGG orthology group: K08770, ubiquitin C (inferred from 100% identity to mgl:MGL_1040)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (154 amino acids)

>mRNA_5889 K02977 RP-S27Ae, RPS27A small subunit ribosomal protein S27Ae (Rhodosporidium toruloides IFO0880)
MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGSA