Protein Info for mRNA_5902 in Rhodosporidium toruloides IFO0880

Name: 14270
Annotation: K08336 ATG12 ubiquitin-like protein ATG12

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 134 PF04110: APG12" amino acids 48 to 134 (87 residues), 112.3 bits, see alignment E=6.2e-37

Best Hits

Swiss-Prot: 58% identical to ATG12_CRYNJ: Ubiquitin-like protein ATG12 (ATG12) from Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)

KEGG orthology group: K08336, autophagy-related protein 12 (inferred from 58% identity to cnb:CNBE3120)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (134 amino acids)

>mRNA_5902 K08336 ATG12 ubiquitin-like protein ATG12 (Rhodosporidium toruloides IFO0880)
MSSLSAQAGTSRPSAVRTGTSSAAATEQGAKLTPREALEASKLKEATKVVVRFKATGNAP
IMKQNFYKITASNQFRAVIAFLRKELAWKPSDPLFLYINSSFAPAPDDTVADLYKCFGTE
NHLIVNYSSTQAWG