Protein Info for mRNA_5910 in Rhodosporidium toruloides IFO0880

Name: 14278
Annotation: K11094 SNRPB2 U2 small nuclear ribonucleoprotein B''

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 PF13893: RRM_5" amino acids 47 to 137 (91 residues), 19.6 bits, see alignment E=6e-08 amino acids 209 to 276 (68 residues), 14.1 bits, see alignment E=3e-06 PF00076: RRM_1" amino acids 58 to 128 (71 residues), 34.7 bits, see alignment E=1.2e-12 amino acids 214 to 277 (64 residues), 49.7 bits, see alignment E=2.6e-17

Best Hits

KEGG orthology group: None (inferred from 46% identity to cne:CNN00230)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (298 amino acids)

>mRNA_5910 K11094 SNRPB2 U2 small nuclear ribonucleoprotein B'' (Rhodosporidium toruloides IFO0880)
MTEISTQPPAEAPAAGPSTSAPPPATNGDAQQANGDVEMADGGADQGVQLPPGASEVLYV
NNLNEKIKLDIMKQSLKVLFREYGRVLGVTAHRNVRMRGQAFVTLDSKEAAVKAVKEVQK
FPLYGKPMQLTFARTESDALVQKRHPDDMEAHKKARLERKKQSRRDDPARRKKLAAKAAA
KQAAETGAAPVAAAPTQRRIVQMPDEYLPPNKILFVQNLPDDTTKEGLEALFRPFPNLVE
VRTIPGRKNIAFVEFADEQSSGVARDALHNTKFSGTTGAVMAQSEEGLKIKVTFAKKG