Protein Info for mRNA_5979 in Rhodosporidium toruloides IFO0880

Name: 14347
Annotation: K12832 SF3B5, SF3B10 splicing factor 3B subunit 5

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 85 PF07189: SF3b10" amino acids 5 to 80 (76 residues), 118.8 bits, see alignment E=4.5e-39

Best Hits

Swiss-Prot: 56% identical to SF3B5_DROME: Splicing factor 3B subunit 5 (Sf3b5) from Drosophila melanogaster

KEGG orthology group: K12832, splicing factor 3B subunit 5 (inferred from 79% identity to scm:SCHCODRAFT_13744)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (85 amino acids)

>mRNA_5979 K12832 SF3B5, SF3B10 splicing factor 3B subunit 5 (Rhodosporidium toruloides IFO0880)
SELRHTANAQIAQLHARYTGTGHADITKYEWITNQHRDTSSSIVGHPALLQYLAIADGET
TARTKFELTERMLQPCGPPPPKEDD