Protein Info for mRNA_6009 in Rhodosporidium toruloides IFO0880

Name: 14377
Annotation: K13939 FOL1 dihydroneopterin aldolase / 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase / dihydropteroate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 808 PF02152: FolB" amino acids 165 to 297 (133 residues), 59.6 bits, see alignment E=6.6e-20 TIGR01498: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase" amino acids 330 to 474 (145 residues), 113.6 bits, see alignment E=1e-36 PF01288: HPPK" amino acids 331 to 474 (144 residues), 114.9 bits, see alignment E=4.4e-37 TIGR01496: dihydropteroate synthase" amino acids 534 to 799 (266 residues), 271.4 bits, see alignment E=1.3e-84 PF00809: Pterin_bind" amino acids 535 to 785 (251 residues), 249.8 bits, see alignment E=5e-78

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (808 amino acids)

>mRNA_6009 K13939 FOL1 dihydroneopterin aldolase / 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase / dihydropteroate synthase (Rhodosporidium toruloides IFO0880)
MTLCDVIRVTDLVLRTPALAPDHWQRPHKDQPLVCSLEIHTHVDDEADTDNLLADSLNYG
TVTKHVERHVRELAVSSSAGEGELSGIPLEVVAEQLAKVVIFRAKAPNVRIELRRPRALL
TADSVGVVLSRSRSEYSLPSADSPSDSLDAYTLLPTATSPANDTLFVRQLRRHVIIGLNP
CERHDEQEVIVDLEFAAPDDGMIASNGARMGWLGWRGAVKRAEEHFTATKPLTIESIVVS
LSSLLLTPHASPSPIPTAPSSSSSTSPQLDWNIPRTTVRVSKPAALMFAKHPSVQVTRSR
ADFPTLFAPPSTRAYSTTPSASGLQTLHTAYIGLGTNLGQRVKNLNDAVSTLDRLGAETG
VTKVVETSWMYESDAMYHEEQERFLNAVVKIETTLHPLRLLTLLKRIESTLGRDFSTFRN
GPRVIDLDLLLYEDVMLDTRETGERDEEGRWLKVPHQGIVEREFVLRPLVDLAPSLVHPA
LKKTPTELLSSLTSSPSFASTVHRVFPLAASLVHPYFRQTSSFLPFASDTRTLIMSILNL
TPDSFSDGDEARSSDVQVALSEARKHLEEGADVVDVGGMSTRPGATDIGSEEEIRRVVPF
VKALRAGEDSKRAVISIDTFRPDVARAALDAGADIINDVYGGREPGMLEVMAEKACPVVL
MHSRGDPSTMTRLTTYDNGLVEGVRREMEEMVEKALAAGVRRWNIILDPGFGFAKSSDQN
FALLRRLPELFASSSTLREYPVLLGLSRKRFLAPEKKDAKERRMETAAAVVACVASGWCE
VVRVHETKDAREIVQVADKIYKSRIGEA