Protein Info for mRNA_6031 in Rhodosporidium toruloides IFO0880

Name: 14399
Annotation: KOG2890 Predicted membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 365 transmembrane" amino acids 15 to 34 (20 residues), see Phobius details amino acids 44 to 70 (27 residues), see Phobius details amino acids 82 to 99 (18 residues), see Phobius details amino acids 111 to 129 (19 residues), see Phobius details amino acids 141 to 164 (24 residues), see Phobius details amino acids 184 to 217 (34 residues), see Phobius details PF08551: DUF1751" amino acids 62 to 162 (101 residues), 89.2 bits, see alignment E=2.2e-29 PF01694: Rhomboid" amino acids 69 to 199 (131 residues), 23.3 bits, see alignment E=5.9e-09

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (365 amino acids)

>mRNA_6031 KOG2890 Predicted membrane protein (Rhodosporidium toruloides IFO0880)
MPAILSTAVSLPPATRYLTLSLVGLSVLYFFVHLSVNPRDLKGIFGATGDASLAFPWLVL
VPGNVIWAPWTLWTAAFVETNFPEFLISILTLPLAARYLERVWGAQELVKFVLVTVVVSN
VIAVGVNVLESVVLGDSALFMYGMSYHGLSALQVAFLVAFTQLIPEHQVQVFGGLFTMRV
KSLPMLYVTFSNIVCVLGYQSPYILVQFGWLVSWFYLRFIKYNEGGDFRGDRSETFAFAS
WFPPFAQKYITIGTTHLFNLAVRFKVLQPWGADIESGVAGVGGGYTQVPGGQRAEAERRR
QLALEALDRRMAAPSGPSTTSPAVPRASSPAANPASPTAARTAVVASVDGSATAPAAGGV
DEKAQ