Protein Info for mRNA_6065 in Rhodosporidium toruloides IFO0880

Name: 14433
Annotation: KOG1082 Histone H3 (Lys9) methyltransferase SUV39H1/Clr4, required for transcriptional silencing

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 218 PF00856: SET" amino acids 71 to 156 (86 residues), 34.8 bits, see alignment E=1.2e-12

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (218 amino acids)

>mRNA_6065 KOG1082 Histone H3 (Lys9) methyltransferase SUV39H1/Clr4, required for transcriptional silencing (Rhodosporidium toruloides IFO0880)
MWLCPRRRQPQLTKAELSLVYSYIERNYLYDLDHWTIGEEIKARAPRAVAKKLAIAAPEA
SHKTTSPGKTKIKGKSVDDVPPVNADLPFDNEGFSSFYSIDAYNYGNWTRFANHVCEGFN
VVPRPVYVDEGDVTRPLWVYFASRDILPGEEINISYFGESEPNPQDYGMTDAEWISAANK
QRAEAPAAHRCYCNKRLCRGRMFHVAGEMFWEKREAGN