Protein Info for mRNA_6066 in Rhodosporidium toruloides IFO0880

Name: 14434
Annotation: K20363 YIP1, YIPF5 protein transport protein YIP1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 transmembrane" amino acids 126 to 145 (20 residues), see Phobius details amino acids 151 to 171 (21 residues), see Phobius details amino acids 183 to 203 (21 residues), see Phobius details amino acids 209 to 232 (24 residues), see Phobius details amino acids 239 to 257 (19 residues), see Phobius details PF04893: Yip1" amino acids 111 to 242 (132 residues), 41.3 bits, see alignment E=7e-15

Best Hits

KEGG orthology group: None (inferred from 58% identity to cci:CC1G_04567)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (262 amino acids)

>mRNA_6066 K20363 YIP1, YIPF5 protein transport protein YIP1 (Rhodosporidium toruloides IFO0880)
MSYYSSQYGQPQPSSSSSLDPNLAFYSGGQPSFYSNRPSLDPDTRPDVSGAIGGGVGGAG
GAAGGAAFGGHIVVQNWWNAFTPWTGMEGEPPLLEELGINFDHILQKSLTVLNPLRSVDP
HIMDDADLAGPLVFCFVFASFLLLSGKPQFSYIYGVALIGSVSMYALLNLMSESGIDAYR
TASVLGYCILPLVLLSMLSVVLSLDGMLGYIISSLIVIWCSYSASSIFASVLHLSHQRFL
VAYPVGLLYTAFSLFVFEVKKH