Protein Info for mRNA_6101 in Rhodosporidium toruloides IFO0880

Name: 14469
Annotation: KOG1303 Amino acid transporters

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 487 transmembrane" amino acids 65 to 88 (24 residues), see Phobius details amino acids 94 to 118 (25 residues), see Phobius details amino acids 139 to 161 (23 residues), see Phobius details amino acids 170 to 192 (23 residues), see Phobius details amino acids 203 to 225 (23 residues), see Phobius details amino acids 253 to 273 (21 residues), see Phobius details amino acids 285 to 307 (23 residues), see Phobius details amino acids 327 to 350 (24 residues), see Phobius details amino acids 370 to 391 (22 residues), see Phobius details amino acids 397 to 420 (24 residues), see Phobius details amino acids 441 to 461 (21 residues), see Phobius details PF01490: Aa_trans" amino acids 64 to 455 (392 residues), 117.2 bits, see alignment E=4e-38

Best Hits

KEGG orthology group: None (inferred from 48% identity to aor:AOR_1_680024)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (487 amino acids)

>mRNA_6101 KOG1303 Amino acid transporters (Rhodosporidium toruloides IFO0880)
MLSRLTTSRTSFSTSASDKHEDKEDDQRARVEAEPDLETVQEEEEVDGVFGTQGGKDTVN
YRRVGWISTSVLLAKMQIGVGVLSIPSVFNVLGLVPGLLCLLVIAGMTTWSAFSIGWFKR
NHPECYSIPDAVKLMAGKVVGEIFAVFFWIFIVFVAGLDFLTISTALNAISLHATCTAIF
VAVAALTCIPLASIRRLDSLAPLTWIGVACLVVAVFVVMVAVAVGGRPALAPKDGPLAIE
IHAFKKANFPDALNAISGLVTAYAGVPAYMSIASEMRDFADFEKSVVLCQSAVTAIYVVV
GVVVYIYAGQYVASPALGTAGVLIKRIAYGIALPGLIVSAVLTLHLCAKFIFVRLLKGSY
HLNHSTPKHWFVWLACTIGCGLFGYTVASAIPAFEGLLGLIGASFGTVMSFHSEALMWLY
DTRSSSLSSSTPLRTRTRLGIALNVLVLILATFLLAGGTYGSALSIRDAYRESGGRPWSC
VDNSGSV