Protein Info for mRNA_6106 in Rhodosporidium toruloides IFO0880

Name: 14474
Annotation: K08332 VAC8 vacuolar protein 8

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 560 PF01602: Adaptin_N" amino acids 59 to 238 (180 residues), 38.9 bits, see alignment E=2.2e-13 PF04826: Arm_2" amino acids 86 to 248 (163 residues), 27.8 bits, see alignment E=9e-10 PF05804: KAP" amino acids 104 to 366 (263 residues), 32.5 bits, see alignment E=1.5e-11 PF00514: Arm" amino acids 116 to 155 (40 residues), 40.9 bits, see alignment 7.5e-14 amino acids 158 to 196 (39 residues), 33.2 bits, see alignment 1.9e-11 amino acids 198 to 237 (40 residues), 44.1 bits, see alignment 7.1e-15 amino acids 285 to 321 (37 residues), 20.5 bits, see alignment 2e-07 amino acids 325 to 364 (40 residues), 31.2 bits, see alignment 8.1e-11 amino acids 409 to 447 (39 residues), 27.3 bits, see alignment 1.4e-09

Best Hits

Swiss-Prot: 76% identical to VAC8_CRYNB: Vacuolar protein 8 (VAC8) from Cryptococcus neoformans var. neoformans serotype D (strain B-3501A)

KEGG orthology group: K08332, vacuolar protein 8 (inferred from 76% identity to cne:CNA03500)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (560 amino acids)

>mRNA_6106 K08332 VAC8 vacuolar protein 8 (Rhodosporidium toruloides IFO0880)
MGVCASCCGGSKSSAPYEPLLLDNEREAVADLLQYLENRSATNFFTGDPLRALSTLSYSD
NVDLQRSAALAFAEITEKDVQEVSRETLEPILFLLNSHDVEVQRAASAALGNLAVNAENK
LTIVKLGGLEPLIRQMLSPNVEVQCNAVGCITNLATHDENKSRIARSGALNPLTRLAKSK
DMRVQRNATGALLNMTHSDENRQQLVAAGAIPVLVSLLGSSDTDVQYYCTTALSNIAVDA
DNRRKLQQSEPRLVVNLIALMDSPSLKVQCQAALALRNLASDEKYQVEIVKNGGLPALLR
LLRSSFLPLVLSAAACVRNVSIHPANESPIIESGFLAPLIDLLAYDENEEVQCHAISTLR
NLAASSESNKRALVDAGAAERIRDLVLQVPVAVQSEMTACAAVLGLSEDIKAELLDLGIL
EVLIPLTASASVEVQGNAAAAIGNLSSKSDDYSAFAAVWKEPAGGLEGYLTRFLESEDST
FTHISIWTLVQLLESGDAQLESLIRSSSALLPLVRRLAEAPQPSSEASDDEDAESGAREI
AELARSAVELIEDGGEVDAQ