Protein Info for mRNA_6119 in Rhodosporidium toruloides IFO0880

Name: 14487
Annotation: K15280 SLC35C2 solute carrier family 35, member C2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 629 transmembrane" amino acids 155 to 177 (23 residues), see Phobius details amino acids 189 to 214 (26 residues), see Phobius details amino acids 229 to 249 (21 residues), see Phobius details amino acids 255 to 276 (22 residues), see Phobius details amino acids 283 to 302 (20 residues), see Phobius details amino acids 308 to 327 (20 residues), see Phobius details amino acids 344 to 364 (21 residues), see Phobius details amino acids 384 to 403 (20 residues), see Phobius details amino acids 413 to 435 (23 residues), see Phobius details amino acids 441 to 460 (20 residues), see Phobius details PF03151: TPT" amino acids 161 to 458 (298 residues), 110.7 bits, see alignment E=1.4e-35 PF16913: PUNUT" amino acids 235 to 464 (230 residues), 32.5 bits, see alignment E=8.6e-12

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (629 amino acids)

>mRNA_6119 K15280 SLC35C2 solute carrier family 35, member C2 (Rhodosporidium toruloides IFO0880)
MNDTVRAQRLVADDADHLGALANPSDIHLAQLDRDIHDPLRRGDSTPTPAYGDARDGYEL
EQRYTDSKGAAGLSHGGQGEDDDRATASGAWAGEGAHARRSSSASYARLDTRTRRSGSFG
ARAGEGARRLRFDDGQGGEKDGSVDKRRLQVLWWRSAAVNVLFILAWYCFSTLISVYNKW
MFSAEHYNFPYPLFVTSIHMLVQWCLAAGAMSVFKGLRPKNRPKPGDYATKIAPCGMATG
LDIGLSNLSLRTITLSFYTMCKSSSLAFVLLFAFLFRLETPSWRLAGIILIITAGVLLMV
STETQFDFVGMCQVLSASALGGLRWSLTQMLLHKESMGMANPIATLLWLAPIMGVTLATC
SLIFDGWGNVFSHEEFWGTMGRTLRTAAAITFPGVLAFSMNVTEFGLIQRTSVVTLSVAG
IFKEVAVIFLSTVVFHDKLTPINISGLCVTIFGISLYNYLKYTQFTEAALRASHGTPQRA
GGHGFDSSAEDSYEEGAPMLPTGESRRGLLNGSASHRLSDSSPSAPHHSLDGADDSPRSS
ADLDAQAAELLGDFDDPVHRLSESDKAHQHDADRIPELDQLLEEDERLRRTEEKAHALER
ELEEGVREHRQARDIEVGDLLSENVGGLR