Protein Info for mRNA_6131 in Rhodosporidium toruloides IFO0880

Name: 14499
Annotation: K01057 PGLS, pgl, devB 6-phosphogluconolactonase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01198: 6-phosphogluconolactonase
  • amino acids 21 to 252 (232 residues), 231.5 bits, E=4.8e-73
• PF01182: Glucosamine_iso
  • amino acids 22 to 237 (216 residues), 248.2 bits, E=4.6e-78

Best Hits

KEGG orthology group: K01057, 6-phosphogluconolactonase [EC: 3.1.1.31] (inferred from 58% identity to uma:UM03811.1)

Predicted SEED Role

"6-phosphogluconolactonase (EC 3.1.1.31), eukaryotic type" in subsystem Entner-Doudoroff Pathway or Pentose phosphate pathway (EC 3.1.1.31)

MetaCyc Pathways

• pentose phosphate pathway (8/8 steps found)
• pentose phosphate pathway (oxidative branch) I (3/3 steps found)
• superpathway of glucose and xylose degradation (13/17 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (12/16 steps found)
• Entner-Doudoroff pathway I (6/9 steps found)
• formaldehyde oxidation I (3/6 steps found)
• heterolactic fermentation (11/18 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of plant hormones
• Pentose phosphate pathway

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.1.31

Protein Sequence (269 amino acids)

>mRNA_6131 K01057 PGLS, pgl, devB 6-phosphogluconolactonase (Rhodosporidium toruloides IFO0880)
MSSEAPAPSKKATEPILYGFPSTDDLSQALANFVLAAQDEALKKQATFKIAISGGSLPKV
LGKNLIGRSDVPWNKWEVFFADERVVPLDHEESNFRLNDENLFTHVPIPRQNIHVIDTSK
LDDPEAVADDYEKQLVASFVGSSSIAFPRFDLVLLGIGPDGHTCSLFPGHPLLNEMDGWV
AWLDDSPKPPPTRITLTYPVLNHAHRVAFVSSGESKQEIMEKVLDHPEEGLPASRVKVIS
PGRVYFFSDEAALGRVKYERTKFEDSSKL