Protein Info for mRNA_6135 in Rhodosporidium toruloides IFO0880

Name: 14503
Annotation: K08614 ADAM28 disintegrin and metalloproteinase domain-containing protein 28

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 910 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 827 to 850 (24 residues), see Phobius details PF13688: Reprolysin_5" amino acids 391 to 606 (216 residues), 154 bits, see alignment E=1.7e-48 PF13583: Reprolysin_4" amino acids 393 to 622 (230 residues), 135.6 bits, see alignment E=5.5e-43 PF13574: Reprolysin_2" amino acids 413 to 617 (205 residues), 142.9 bits, see alignment E=3.5e-45 PF13582: Reprolysin_3" amino acids 422 to 567 (146 residues), 44.3 bits, see alignment E=7.5e-15 PF01421: Reprolysin" amino acids 478 to 626 (149 residues), 32.6 bits, see alignment E=2.4e-11 PF00200: Disintegrin" amino acids 649 to 723 (75 residues), 68.4 bits, see alignment E=2.3e-22

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (910 amino acids)

>mRNA_6135 K08614 ADAM28 disintegrin and metalloproteinase domain-containing protein 28 (Rhodosporidium toruloides IFO0880)
MRLWQTPSASLVLATLALTASLAKAASHRPPPLHECALSHPQDLSIHIIPRAQPPASRSP
FERRSGESVEGGAGVVRLTAGGNPAWDDRFLLSFLAHDGEPVTLSLRPTADLVPTNGVKS
VERWLDDETGEWKEHVTVLTRENVKAYEGWVLDDEADVQKWVKEEQAGLVRGAEAGSGWA
RIVVLSTPDDEQNLRFQGTYSKGGEMFTIHSTEQYLRTKDDLDPEPPLVTPSRRSRRAFG
GADDAVLAPRHPSMVIVRESATLSPVEHISALRKRGLPLPDPATLSSASSCSHDSLPFNV
DPAHPVYANSHHPLDTYSNSSSLSSPWLSFLSSPSIQPFTPADHSTPFNSYRYVPSDRHR
KRQGDDISGGSGSSSNFINSIGSTTGCPKQNVVLFVGVAADCTYTTAQRSSDAARQQILT
DFNSVSALYQRSFNVSLGIVELAVMNSTCPSSSSQVDPSNPWNLPCQSGSTGGTGSSIGV
DLNTRLSIFSQWRGDKGAQDGAGLWHLLTTCQTGSEVGVAWLGQLCRTASSSQGGQTTSG
TGVTAATRSEWQVIAHEIGHNFGAIHDCASGCSLSGNCCPLSSSTCDANANYIMSPASEK
NVSSFSPCSVGNICTTLSSSLNTTCLATPGASNNPSIISLRSCGNGIVESGEECDPGSDT
NDPCCDASTCKFRSGAVCNPKNSLCCTTQCQIANNGTVCRPSVDSQCDIAEVCDGSSASC
PADSYKKDGTGCGGGLSCASGVCTSRDQQCRNAGASMGLTRACPTSASSSCSIICQDPSS
SSSCIILDQSFRDGTACQNGGRCKSGSCNTGSALDTAKGWYRDHLQIAIPVTIVVGLIVL
AILWAILRCLCCRGGRAKPAKNQSYSSAYATGPSPMAQNTPYGYYPSSAPQQQGGYYAPP
PGPPPARLRR