Protein Info for mRNA_6150 in Rhodosporidium toruloides IFO0880
Name: 14518
Annotation: KOG3399 Predicted Yippee-type zinc-binding protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 48% identical to YPL1_DROME: Protein yippee-like CG15309 (CG15309) from Drosophila melanogaster
KEGG orthology group: None (inferred from 43% identity to cci:CC1G_02279)Predicted SEED Role
No annotation
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (122 amino acids)
>mRNA_6150 KOG3399 Predicted Yippee-type zinc-binding protein (Rhodosporidium toruloides IFO0880) MSTDLNHSDAHTFLPPTVPSFACGTCGLEVALQDELVSRSFQGTSGPAYLFRTAVNVDIG TKTSKQLLSGKHVISPIHCSGCSTELGWKYFVSPDSSQKYKEGKCILEKSKIYKDNKWSL DD