Protein Info for mRNA_6175 in Rhodosporidium toruloides IFO0880

Name: 14543
Annotation: KOG0255 Synaptic vesicle transporter SVOP and related transporters (major facilitator superfamily)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 539 transmembrane" amino acids 68 to 89 (22 residues), see Phobius details amino acids 104 to 124 (21 residues), see Phobius details amino acids 136 to 154 (19 residues), see Phobius details amino acids 161 to 186 (26 residues), see Phobius details amino acids 195 to 215 (21 residues), see Phobius details amino acids 224 to 244 (21 residues), see Phobius details amino acids 301 to 326 (26 residues), see Phobius details amino acids 339 to 359 (21 residues), see Phobius details amino acids 380 to 399 (20 residues), see Phobius details amino acids 404 to 425 (22 residues), see Phobius details amino acids 447 to 461 (15 residues), see Phobius details amino acids 473 to 493 (21 residues), see Phobius details PF07690: MFS_1" amino acids 78 to 421 (344 residues), 107.3 bits, see alignment E=4.2e-35

Best Hits

KEGG orthology group: None (inferred from 51% identity to pcs:Pc19g00430)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (539 amino acids)

>mRNA_6175 KOG0255 Synaptic vesicle transporter SVOP and related transporters (major facilitator superfamily) (Rhodosporidium toruloides IFO0880)
MPAYKPTTINASLFPDGDTAEDERVEHAPGDASKAEGLDGYDKNKIVLVQFEEGDPENPL
NWSRARKWVITILLDAMTVMIGLSTTAYSSGIGSMTEEFGVANVVGQIGMTTFNATCAIA
PLFLAPLCELVGRREIYLGAYLCFTLIFILLALSPNITGILIGRALSGLFGCVGTILVGG
TLADIWNTRDRGLPMSTFTFSAIFGTVAAPIYCGYIDQAIGWRWIEWIHMIASGILLILE
VFLLKETRGAKILAQRAKKLRKETGRNNIRAPIELENESVKDLLKTSCTKSFILLVREPT
ILAFGLWIAYAWFLTFLFLSAIPLAFQHTSRAWPEGNGGLPYIALVIGCFIGFGTSRWTD
SIYDRKRAANNGVPVPEFRLWGAMYFAWLMPAGLFIFSFTQYGFVHWMGPMVALVLILVR
SYHIFNATYNYTSDYTPENASSAIAGQGLLRNLAGAASPLFANQMFTGMGYQYAGLLLSL
VASLAIPLPYLLFRYGERIRAKSKFASSNEALEKERTTDENVDERPRIAREATYSGSFV