Protein Info for mRNA_6177 in Rhodosporidium toruloides IFO0880

Name: 14545
Annotation: K00868 pdxK, pdxY pyridoxine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00687: pyridoxal kinase
  • amino acids 9 to 269 (261 residues), 172.2 bits, E=8.2e-55
• PF08543: Phos_pyr_kin
  • amino acids 88 to 194 (107 residues), 34.7 bits, E=6.5e-13

Predicted SEED Role

"Pyridoxal kinase (EC 2.7.1.35)" in subsystem Pyridoxin (Vitamin B6) Biosynthesis (EC 2.7.1.35)

MetaCyc Pathways

• pyridoxal 5'-phosphate salvage II (plants) (8/9 steps found)
• pyridoxal 5'-phosphate salvage I (5/6 steps found)
• superpathway of pyridoxal 5'-phosphate biosynthesis and salvage (7/12 steps found)
• 4-amino-2-methyl-5-diphosphomethylpyrimidine biosynthesis II (5/10 steps found)

KEGG Metabolic Maps

• Vitamin B6 metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.35

Protein Sequence (357 amino acids)

>mRNA_6177 K00868 pdxK, pdxY pyridoxine kinase (Rhodosporidium toruloides IFO0880)
MAQANVTQEKRILSIQSHVVCGYVGNKSASFPLQLLGWEVDAALTVSFSNHTVRYGRWGG
SKFDAAHLEDVFSALDANGLLRQSHVLTGYVPGADALKVVVLAVDRLRAINPSLVYILDP
VMGDDGRIYVSESVIPIYKALLPRATCATPNYFEAELLTDIKILDATSLQLALRTFHERY
RIPNIVVSAVSLPLSELVKLGFVDAPALTTSSSTSRMLVCAGSTLVSAPGEPLKTTSFGI
AFPELAEHYEGVGDVFSALVAGRFPSASDPAFAAHPISPLARTVELAIASLQGILAKTRQ
HALSLAKGRADLIVPREGESAEERVRRLRTVELRLVQSQQEILNPDVKHRAVRFSGV