Protein Info for mRNA_6179 in Rhodosporidium toruloides IFO0880

Name: 14547
Annotation: KOG2101 Intermediate filament-like protein, sorting nexins, and related proteins containing PX (PhoX) domain(s)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 472 transmembrane" amino acids 273 to 294 (22 residues), see Phobius details amino acids 315 to 341 (27 residues), see Phobius details PF02194: PXA" amino acids 56 to 242 (187 residues), 174.9 bits, see alignment E=8.5e-56

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (472 amino acids)

>mRNA_6179 KOG2101 Intermediate filament-like protein, sorting nexins, and related proteins containing PX (PhoX) domain(s) (Rhodosporidium toruloides IFO0880)
MAALRTVPSRKRGPPVSTTVPTEVDRAQAQPLHRRILFPPSSSAESPRILHSSAHETLDP
LILDLIALSLRAYVTPWYNGAISRDPDKAFLQAVTAVLVHVVQALEVRLAAVDWANVLLS
ELPDVLANHYRDWDSAVERAGGGMAHNLSVDDMFHHLQPHIAIHLRQAAEGETTARHRVT
PEVDRVYLRALVNRLLKLLLPPEDYRSETERAIVREIIVGVVFGTVFNRVAQPWFIHGLI
AKQLEAREAERAVAQKTAAADDRPAGTGFVDKAFTALLSLPLLFASLASTFSALSSSART
TSSDRSSSPPPHESLIALILAVVPSSVFLSQLVYLVSLPLAFFSTQLGSFLAQSVTGHAC
SASTVKVVLEGAIKGMFPNDGWPAPKEEDPDEEAQDELRRRCEEALARALPSSIPSLLYP
RLPAEPPDPRIHLARHLLRPLTSHTANVHLFLSIVDLVVGKVFPELIVAPED