Protein Info for mRNA_6181 in Rhodosporidium toruloides IFO0880

Name: 14549
Annotation: K13126 PABPC polyadenylate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 715 TIGR01628: polyadenylate binding protein, human types 1, 2, 3, 4 family" amino acids 74 to 461 (388 residues), 611.1 bits, see alignment E=1.7e-187 PF00076: RRM_1" amino acids 75 to 144 (70 residues), 62 bits, see alignment E=3.8e-21 amino acids 163 to 231 (69 residues), 64.3 bits, see alignment E=7.3e-22 amino acids 256 to 324 (69 residues), 70.5 bits, see alignment E=8.5e-24 amino acids 359 to 427 (69 residues), 72.9 bits, see alignment E=1.5e-24 PF00658: PABP" amino acids 617 to 683 (67 residues), 97.5 bits, see alignment E=4.1e-32

Best Hits

KEGG orthology group: K13126, polyadenylate-binding protein (inferred from 63% identity to cci:CC1G_04203)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (715 amino acids)

>mRNA_6181 K13126 PABPC polyadenylate-binding protein (Rhodosporidium toruloides IFO0880)
MSTDAASTTPAASEAPATASSPAPAADNTPAPAAAAAADNKDEAKPASSESNAAPASQNQ
GSSSSNTGPSPSTSLYIGELDPTVTEAMLYEIFSMIGPVASIRVCRDAVTRRSLGYAYVN
YLNSADGERALEQLNYSSIKGRPCRIMWSQRDPSLRKNGAGNIFIKNLDENIDNKALHDT
FAAFGNILSCKVAVDGQGNSLGYGFVHYDTPEAARAAIEGVNGMLLNDKVVYVGIHIPKR
ERQAKIDEIRAHFTNLYIKNVPLEVDEAEFRGLFEPFGKVTSAVITKDAEGNSKGFGFVN
YERHEDAAKAVDALHDKDYKGQNLYVARAQRKSEREEELKKSYEQKKYEANLKYQGVNLY
VKNLDDDIDEEKLRAEFEPYGQITSCKIMSDDKGASKGFGFVCFSAPDEATKALTELNGK
MLGTKPLYVALAQRKDVRKQQLEAQVAQRQQIRAQQMQAAGIPGIPPYMPGAPMYYGPAG
YPQPGARGPMGYPQPGPGGMPRPRFYAPPNMPGMPPMPYPPQQFGQYPPPPPGAAGPRGA
AGAPPAGPGGRPGQPPAMPAGVPPPRGGPVPNGAPIPPRGAPVPPNGVPRPAAQAGQPPQ
RRPRAEEQKAQGGLTAAMLANAAPQEQKQMLGEALYPRIHASQPELAGKVTGMLLEMDSS
ELLYLLENDEALAAKVQEALDVLAEYNQRQTGDEASGEEAPAAAPAAEATEEASA