Protein Info for mRNA_6216 in Rhodosporidium toruloides IFO0880

Name: 14584
Annotation: K03120 TBP, tbp transcription initiation factor TFIID TATA-box-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00352: TBP
  • amino acids 59 to 136 (78 residues), 110.9 bits, E=2.4e-36
  • amino acids 145 to 227 (83 residues), 109 bits, E=9.1e-36

Best Hits

KEGG orthology group: K03120, transcription initiation factor TFIID TATA-box-binding protein (inferred from 70% identity to ncr:NCU04770)

Predicted SEED Role

"TATA-box binding protein" in subsystem RNA polymerase III initiation factors or RNA polymerase II initiation factors or RNA polymerase archaeal initiation factors

Protein Sequence (231 amino acids)

>mRNA_6216 K03120 TBP, tbp transcription initiation factor TFIID TATA-box-binding protein (Rhodosporidium toruloides IFO0880)
MSGLVLPSRGTSINGNGSSNGVASGSGAAHAGSGANAGASGSGAAMDVDTRFGSPSSRRN
IVATVNLECKLDLKTIALHARNAEYNPKRFAAVIMRIREPKTTALVFASGKVVVTGAKSE
DDSRLAARKYARIIQKLGFETKFTDFKIQNIVGSCDVKFPIRLEGLAYGHGHFSSYEPEL
FPGLIYRMVKPKVVLLIFVSGKIVLTGAKFREEIYQAFAQIYPVLNEYRKP