Protein Info for mRNA_6218 in Rhodosporidium toruloides IFO0880

Name: 14586
Annotation: K03687 GRPE molecular chaperone GrpE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 156 PF01025: GrpE" amino acids 7 to 152 (146 residues), 136.8 bits, see alignment E=2.9e-44

Best Hits

Predicted SEED Role

"Heat shock protein GrpE" in subsystem Heat shock dnaK gene cluster extended or Protein chaperones

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (156 amino acids)

>mRNA_6218 K03687 GRPE molecular chaperone GrpE (Rhodosporidium toruloides IFO0880)
MASCATRQDARLRTLADFENLQKISTREKQQAKDFALQAFAKDLISEIDVLNLALRSIPA
ERLVSSSDHTPNSDLLGLHEGVKLTKRGIEKVLAKHGVVAFDPTGEQFDPNRHEALYQAP
VPGKEPGSVLECQEIGYMIKDRLLRPAKVGVVLWTE