Protein Info for mRNA_6244 in Rhodosporidium toruloides IFO0880

Name: 14612
Annotation: K07901 RAB8A, MEL Ras-related protein Rab-8A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 215 PF00025: Arf" amino acids 8 to 156 (149 residues), 51 bits, see alignment E=3.7e-17 TIGR00231: small GTP-binding protein domain" amino acids 12 to 165 (154 residues), 92.8 bits, see alignment E=1e-30 PF04670: Gtr1_RagA" amino acids 13 to 128 (116 residues), 22 bits, see alignment E=2.8e-08 PF08477: Roc" amino acids 13 to 127 (115 residues), 117.9 bits, see alignment E=9.2e-38 PF00071: Ras" amino acids 13 to 173 (161 residues), 214.2 bits, see alignment E=2.6e-67 PF00009: GTP_EFTU" amino acids 45 to 146 (102 residues), 27.1 bits, see alignment E=9.1e-10

Best Hits

Swiss-Prot: 77% identical to RAB8A_DICDI: Ras-related protein Rab-8A (rab8A) from Dictyostelium discoideum

KEGG orthology group: K07901, Ras-related protein Rab-8A (inferred from 81% identity to cci:CC1G_12192)

Predicted SEED Role

"Pro-zeta-carotene desaturase, prolycopene producing (EC 1.-.-.-)" in subsystem Carotenoids (EC 1.-.-.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (215 amino acids)

>mRNA_6244 K07901 RAB8A, MEL Ras-related protein Rab-8A (Rhodosporidium toruloides IFO0880)
MPAPQQSYDMLAKMLLIGDSGVGKSCLLLRFCDDAWTPSFITTIGIDFKIRTIELEGKRI
KLQIWDTAGQERFRTITTAYYRGAMGILLVYDVTDERSFNNIRTWHQNVEQHASEGVNKI
LIGNKCDWTDKKVISEQQGQELADELGLRFLETSAKSNINVEQAFFALASDIKARLLDTA
TGAAGAGGAAAGSAGSNSVGLGSGQGNAENKSGCC