Protein Info for mRNA_6265 in Rhodosporidium toruloides IFO0880

Name: 14633
Annotation: K07897 RAB7A Ras-related protein Rab-7A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 207 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF00025: Arf" amino acids 9 to 170 (162 residues), 47.1 bits, see alignment E=4.8e-16 PF00071: Ras" amino acids 10 to 176 (167 residues), 190.6 bits, see alignment E=3.8e-60 PF04670: Gtr1_RagA" amino acids 10 to 143 (134 residues), 24.5 bits, see alignment E=4e-09 PF08477: Roc" amino acids 10 to 129 (120 residues), 112.9 bits, see alignment E=2.9e-36 TIGR00231: small GTP-binding protein domain" amino acids 10 to 169 (160 residues), 83.6 bits, see alignment E=6.8e-28 PF01926: MMR_HSR1" amino acids 10 to 125 (116 residues), 31.7 bits, see alignment E=3.7e-11

Best Hits

Swiss-Prot: 76% identical to RAB7_NEUCR: Probable Ras-related protein Rab7 (17E5.300) from Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)

KEGG orthology group: K07897, Ras-related protein Rab-7A (inferred from 79% identity to cnb:CNBK2830)

Predicted SEED Role

"Pro-zeta-carotene desaturase, prolycopene producing (EC 1.-.-.-)" in subsystem Carotenoids (EC 1.-.-.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (207 amino acids)

>mRNA_6265 K07897 RAB7A Ras-related protein Rab-7A (Rhodosporidium toruloides IFO0880)
MASRRKVLLKVIILGDSGVGKTSLMNQYVNKRFSNQYKATIGADFLTKEVVVDDRLVTMQ
LWDTAGQERFQSLGVAFYRGADCCVLVYDVNSSKSFETLDSWRDEFLIQASPRDPENFPF
IVIGNKVDMDPSKRMVSQKRAMTWCESKGKIPYFETSAKDATNVEQAFQAACRNALEQEG
NADVLDDYPDPIRINAHDADAKYGCSC