Protein Info for mRNA_6273 in Rhodosporidium toruloides IFO0880

Name: 14641
Annotation: HMMPfam-Chitin synthase III catalytic subunit-PF12271

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 335 transmembrane" amino acids 15 to 29 (15 residues), see Phobius details amino acids 54 to 73 (20 residues), see Phobius details amino acids 85 to 107 (23 residues), see Phobius details amino acids 113 to 138 (26 residues), see Phobius details amino acids 150 to 173 (24 residues), see Phobius details amino acids 188 to 211 (24 residues), see Phobius details amino acids 223 to 243 (21 residues), see Phobius details amino acids 255 to 273 (19 residues), see Phobius details PF12271: Chs7" amino acids 8 to 286 (279 residues), 378.6 bits, see alignment E=1.1e-117

Best Hits

Swiss-Prot: 54% identical to CHS7_CRYNJ: Chitin synthase export chaperone (CHS7) from Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)

KEGG orthology group: None (inferred from 59% identity to scm:SCHCODRAFT_83552)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (335 amino acids)

>mRNA_6273 HMMPfam-Chitin synthase III catalytic subunit-PF12271 (Rhodosporidium toruloides IFO0880)
MTSNATLSFGSYDWICSRAALIVCPLLGATNYGIEPVCYSRNVEFGRTLVFQPATSFMHI
CALAMVIVMILHVRSKYTAVGRKEILIFFYIYFLEELLAIFLDSGIIPPSSNVYAWFAAV
HTGLTAATYWCLLVNGFVGFQMVEDGTPLSLWTLQGTSAIVGLIVGLVAIGTFKNSAGLS
SAKPTGLWILQFIFPLACVVVYIVAQFFLVLRTLDDRWPIGDILFGTAFWVIAQVLLFAF
SNTICDAVSHYLDGTFFHALCNLFAVMMTYKYWDSLTKEDLEFSVSSKEKAWEVKETLLR
EDDDDSPSGSGYGGGAGYGQGAYPPQKGGYGQYGY