Protein Info for mRNA_6288 in Rhodosporidium toruloides IFO0880

Name: 14656
Annotation: KOG0876 Manganese superoxide dismutase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 196 PF00081: Sod_Fe_N" amino acids 1 to 78 (78 residues), 70.4 bits, see alignment E=1.5e-23 PF02777: Sod_Fe_C" amino acids 96 to 196 (101 residues), 94.7 bits, see alignment E=3.5e-31

Best Hits

Swiss-Prot: 44% identical to SODM1_ARATH: Superoxide dismutase [Mn] 1, mitochondrial (MSD1) from Arabidopsis thaliana

KEGG orthology group: K04564, superoxide dismutase, Fe-Mn family [EC: 1.15.1.1] (inferred from 44% identity to cne:CNI01590)

Predicted SEED Role

No annotation

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.15.1.1

Use Curated BLAST to search for 1.15.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (196 amino acids)

>mRNA_6288 KOG0876 Manganese superoxide dismutase (Rhodosporidium toruloides IFO0880)
LPPLPYAYNALDPFIIEDITRLHHDVGHLAHVTALNLAVANMSTAIQCGNIEEVVRITES
LAFNGGGHINHSLFWRSLAPAASSSSNGTGGLFPTSGALHDHVSTSFGSVEQLSAVMVTA
GSGIRGSGWVWATEASSRLQLEVITTANQNLPFAWQVPILGIDCFEHAYLLQYKTNRLEY
LKSVFAVVNWQEAEAR