Protein Info for mRNA_6305 in Rhodosporidium toruloides IFO0880

Name: 14673
Annotation: HMMPfam-FAM72 protein-PF14976,ProSitePatterns-Zinc finger C2H2 type domain signature.-PS00028

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 241 PF14976: FAM72" amino acids 40 to 152 (113 residues), 76.3 bits, see alignment E=1.5e-25

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (241 amino acids)

>mRNA_6305 HMMPfam-FAM72 protein-PF14976,ProSitePatterns-Zinc finger C2H2 type domain signature.-PS00028 (Rhodosporidium toruloides IFO0880)
MHSQQLAQPHPRSDQYSSREQYLQQPARPQQPATIPIHRVYVLRCATCDTFLSDRGMRAV
LLLKPHIVLFSTDAAPANSETFWPGELGEEEHVERTCSCLTSSINCHGCGKTVGYHIVSP
CAKCTASVQKHQRTANHHRYVFHHNEVTSRERTYFPDERGVNNPFVARYSAPVAASSPNR
HCRSAGEEAADAASSARSRHSERLLKAGDTLYWHLLIPGGERCQSIDPQTREPVWSENVG
R