Protein Info for mRNA_6339 in Rhodosporidium toruloides IFO0880

Name: 14707
Annotation: K03265 ETF1, ERF1 peptide chain release factor subunit 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 458 TIGR03676: peptide chain release factor 1, archaeal and eukaryotic forms" amino acids 13 to 433 (421 residues), 417.3 bits, see alignment E=2.9e-129 PF03463: eRF1_1" amino acids 17 to 137 (121 residues), 66.8 bits, see alignment E=4.9e-22 PF18854: baeRF_family10" amino acids 131 to 254 (124 residues), 37.5 bits, see alignment E=6.9e-13 PF03464: eRF1_2" amino acids 143 to 275 (133 residues), 163.1 bits, see alignment E=1.1e-51 PF18859: acVLRF1" amino acids 146 to 243 (98 residues), 37.1 bits, see alignment E=9.1e-13 PF03465: eRF1_3" amino acids 278 to 433 (156 residues), 124.2 bits, see alignment E=9.4e-40

Best Hits

Predicted SEED Role

"Eukaryotic peptide chain release factor subunit 1" in subsystem Translation elongation factors eukaryotic and archaeal

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (458 amino acids)

>mRNA_6339 K03265 ETF1, ERF1 peptide chain release factor subunit 1 (Rhodosporidium toruloides IFO0880)
MADAQQEANIAVWKMKKLVQSLQAARGAGTSMISLIAPPRSQISQLQSMLTQEYGTASNI
KSRVNRLSVLAAITSTQQRLKLYSKVPPNGLIIYCGTILTDEGKEKKVNIDFEPFKPINT
SLYLCDNKFHTEALAELLESDAKFGFIVMDGNGALFGTLAGNTREVIHKFSVDLPKKHGR
GGQSALRFARLRMEKRHNYVRKVAELAVQHFITDDKVNVQGLVLAGSADFKTELNQSDMF
DQRLQAKVIKVVDVSYGGENGFNQAIELAAESLSNVKFVQEKKLISRYFDEISHDSGKYC
FGVDDTLRGLEMGAVETLIVWENLDVTRHVLRDSQGAEHVVHTQAPPPSASNNKAEAAVG
IAALSEMDREKFIDKATGLEMEQAAEPVNLLEWLSEKYKDFGAEIEIVTNKSQEGSQFVK
GFGGIGGLLRYKVDFAEIADALEQADEDEFYDSDEDFI