Protein Info for mRNA_6343 in Rhodosporidium toruloides IFO0880

Name: 14711
Annotation: K12621 LSM2 U6 snRNA-associated Sm-like protein LSm2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 94 PF01423: LSM" amino acids 6 to 71 (66 residues), 61.2 bits, see alignment E=3.1e-21

Best Hits

Swiss-Prot: 71% identical to LSM2_ARATH: Sm-like protein LSM2 (LSM2) from Arabidopsis thaliana

KEGG orthology group: K12621, U6 snRNA-associated Sm-like protein LSm2 (inferred from 75% identity to scm:SCHCODRAFT_58515)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (94 amino acids)

>mRNA_6343 K12621 LSM2 U6 snRNA-associated Sm-like protein LSm2 (Rhodosporidium toruloides IFO0880)
MLIFSVLKTLQDQELTVELKNDMAIRGQLKSVDQFLNIKLDNIRVLDEDRYPHMIAVRNC
FIRGSTVRYVQLPRAAVDTQLLEDATRREAGKQR