Protein Info for mRNA_6352 in Rhodosporidium toruloides IFO0880

Name: 14720
Annotation: K02980 RP-S29e, RPS29 small subunit ribosomal protein S29e

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 56 PF00253: Ribosomal_S14" amino acids 7 to 54 (48 residues), 51.9 bits, see alignment E=2.6e-18

Best Hits

Swiss-Prot: 75% identical to RS29_NEUCR: 40S ribosomal protein S29 (rps-29) from Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)

KEGG orthology group: K02980, small subunit ribosomal protein S29e (inferred from 77% identity to scm:SCHCODRAFT_65141)

Predicted SEED Role

"SSU ribosomal protein S29e (S14p)" in subsystem Ribosome SSU eukaryotic and archaeal

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (56 amino acids)

>mRNA_6352 K02980 RP-S29e, RPS29 small subunit ribosomal protein S29e (Rhodosporidium toruloides IFO0880)
MTHEAVWFSHPRKYGKGSRGCRICQHQAGLIRKYGLNICRQCFRERADVIGFAKNR